-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDAC8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against HDAC8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-17240A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDAC8 |
| Target Synonyms | HD8; WTS; RPD3; CDA07; CDLS5; KDAC8; MRXS6; HDACL1; C8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse thymus, Raji, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY | Uniprot ID | Q9BY41 |
Uniprot Id
Q9BY41
Target Species
Human
Target Name
HDAC8
Target Full Name
Histone deacetylase 8
Target Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Also involved in the deacetylation of cohesin complex protein SMC3 regulating release of cohesin complexes from chromatin. May play a role in smooth muscle cell contractility.
Target Involvement
Cornelia de Lange syndrome 5 (CDLS5); Wilson-Turner X-linked mental retardation syndrome (WTS)
Target Subcellular Location
Nucleus. Cytoplasm. Note=Excluded from the nucleoli. Found in the cytoplasm of cells showing smooth muscle differentiation.
Target Protein Families
Histone deacetylase family, HD type 1 subfamily
Target Tissue Specificity
Weakly expressed in most tissues. Expressed at higher level in heart, brain, kidney and pancreas and also in liver, lung, placenta, prostate and kidney.
Target Research Area
Transcription
Target Synonyms
CDA07; CDLS5; HD 8; HD8; HDAC 8; Hdac8; HDAC8_HUMAN; HDACL 1; HDACL1; Histone deacetylase 8; Histone deacetylase like 1 ; MRXS6; RPD 3; RPD3; WTS
Target Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification