Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HE4/WFDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HE4/WFDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02843A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HE4/WFDC2 |
| Target Synonyms | HE4; WAP5; EDDM4; dJ461P17.6; HE4/WFDC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF | Uniprot ID | Q14508 |
Uniprot Id
Q14508
Target Species
Human
Target Name
WFDC2
Target Full Name
WAP four-disulfide core domain protein 2
Target Function
Broad range protease inhibitor.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described
Target Synonyms
HE4; WAP5; EDDM4; dJ461P17.6; HE4/WFDC2
Target Background
This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
