Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HES5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 12-142 of human HES5 (Q5TA89) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HES5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 12-142 of human HES5 (Q5TA89) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16224A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HES5 |
| Target Synonyms | bHLHb38; HES5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse spleen, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 12-142 of human HES5 (Q5TA89). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPP | Uniprot ID | Q5TA89 |
Uniprot Id
Q5TA89
Target Species
Human
Target Name
HES5
Target Full Name
Transcription factor HES-5
Target Function
Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in fetal heart and brain tumors.
Target Synonyms
bHLHb38; Class B basic helix-loop-helix protein 38; Hairy and enhancer of split 5; Hairy/Enhancer of spli, Drosophila, homolog of, 5; HES 5; hes family bHLH transcription factor 5; Hes5; HES5 protein; HES5_HUMAN; MGI:104876; Transcription factor HES-5
Target Background
This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
