-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HLTF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HLTF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16645A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HLTF |
| Target Synonyms | ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3; HLTF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, HepG2, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL | Uniprot ID | Q14527 |
Uniprot Id
Q14527
Target Species
Human
Target Name
HLTF
Target Full Name
Helicase-like transcription factor
Target Function
Has both helicase and E3 ubiquitin ligase activities. Possesses intrinsic ATP-dependent nucleosome-remodeling activity; This activity may be required for transcriptional activation or repression of specific target promoters. These may include the SERPINE1 and HIV-1 promoters and the SV40 enhancer, to which this protein can bind directly. Plays a role in error-free postreplication repair (PRR) of damaged DNA and maintains genomic stability through acting as a ubiquitin ligase for 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus. Nucleus, nucleoplasm.
Target Protein Families
SNF2/RAD54 helicase family, RAD16 subfamily
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Target Synonyms
DNA-binding protein/plasminogen activator inhibitor 1 regulator; Helicase like transcription factor; Helicase-like transcription factor; HIP116; HIP116A; HLTF 1; Hltf; HLTF_HUMAN; HLTF1; p113; RING finger protein 80; RNF80; SMARC A3; SMARCA 3; SMARCA3; SNF2-like 3; SNF2L3; Sucrose nonfermenting protein 2 like 3; Sucrose nonfermenting protein 2-like 3; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3; ZBU 1; ZBU1
Target Background
This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.
Notification