-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMBS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HMBS (P08397) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HMBS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HMBS (P08397) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13775A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMBS |
| Target Synonyms | UPS; PBGD; PORC; PBG-D; HMBS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Hep G2, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HMBS (P08397). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNI | Uniprot ID | P08397 |
Uniprot Id
P08397
Target Species
Human
Target Name
HMBS
Target Full Name
Porphobilinogen deaminase
Target Function
As part of the heme biosynthetic pathway, catalyzes the sequential polymerization of four molecules of porphobilinogen to form hydroxymethylbilane, also known as preuroporphyrinogen. Catalysis begins with the assembly of the dipyrromethane cofactor by the apoenzyme from two molecules of porphobilinogen or from preuroporphyrinogen. The covalently linked cofactor acts as a primer, around which the tetrapyrrole product is assembled. In the last step of catalysis, the product, preuroporphyrinogen, is released, leaving the cofactor bound to the holodeaminase intact.
Target Involvement
Acute intermittent porphyria (AIP)
Target Subcellular Location
Cytoplasm.
Target Protein Families
HMBS family
Target Tissue Specificity
[Isoform 1]: Is ubiquitously expressed.; [Isoform 2]: Is found only in erythroid cells.
Target Synonyms
HEM3_HUMAN; HMBS; Hydroxymethylbilane synthase; PBG D; PBG-D; PBGD; PORC; Porphobilinogen deaminase; porphyria, acute, Chester type; Pre uroporphyrinogen synthase; Pre-uroporphyrinogen synthase; UPS; Uroporphyrinogen I synthase; Uroporphyrinogen I synthetase
Target Background
This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification