-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNF4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 155-254 of human HNF4A (NP_000448.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HNF4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 155-254 of human HNF4A (NP_000448.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11441A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNF4A |
| Target Synonyms | TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; TCF-14; HNF4alpha; HNF4A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HNF4A (NP_000448.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRH | Uniprot ID | P41235 |
Uniprot Id
P41235
Target Species
Human
Target Name
HNF4A
Target Full Name
Hepatocyte nuclear factor 4-alpha
Target Function
Transcriptional regulator which controls the expression of hepatic genes during the transition of endodermal cells to hepatic progenitor cells, facilitating the recruitment of RNA pol II to the promoters of target genes. Activates the transcription of CYP2C38. Represses the CLOCK-ARNTL/BMAL1 transcriptional activity and is essential for circadian rhythm maintenance and period regulation in the liver and colon cells.
Target Involvement
Maturity-onset diabetes of the young 1 (MODY1); Diabetes mellitus, non-insulin-dependent (NIDDM); Fanconi renotubular syndrome 4 with maturity-onset diabetes of the young (FRTS4)
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Research Area
Cancer
Target Synonyms
FLJ39654; FRTS4; Hepatic nuclear factor 4 alpha; Hepatocyte nuclear factor 4 alpha; Hepatocyte nuclear factor 4; Hepatocyte nuclear factor 4-alpha; HNF 4 alpha; HNF 4; HNF-4-alpha; HNF4 ; HNF4A; HNF4A_HUMAN; HNF4a7; HNF4a8; HNF4a9; Hnf4alpha; HNF4alpha10/11/12; MODY 1; MODY; MODY1; NR2A1 ; NR2A21; Nuclear receptor subfamily 2 group A member 1; OTTHUMP00000031060; OTTHUMP00000031062; TCF 14; TCF; TCF-14; TCF14 ; Tcf4; Transcription factor 14, hepatic nuclear factor; Transcription factor 14; Transcription factor HNF 4; Transcription factor HNF-4; Transcription factor HNF4
Target Background
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Notification