Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRNPA0 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HNRNPA0 (NP_006796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against HNRNPA0 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HNRNPA0 (NP_006796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-08574A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRNPA0 |
| Target Synonyms | HNRPA0; HNRNPA0 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, BT-474, MCF-7, Mouse brain, Mouse spleen, SKOV3 | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HNRNPA0 (NP_006796.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIY | Uniprot ID | Q13151 |
Uniprot Id
Q13151
Target Species
Human
Target Name
HNRNPA0
Target Full Name
Heterogeneous nuclear ribonucleoprotein A0
Target Function
mRNA-binding component of ribonucleosomes. Specifically binds AU-rich element (ARE)-containing mRNAs. Involved in post-transcriptional regulation of cytokines mRNAs.
Target Subcellular Location
Nucleus.
Target Synonyms
Heterogeneous nuclear ribonucleoprotein A0; hnRNA binding protein; hnRNP A0; HNRNPA0; HNRPA0; ROA0_HUMAN
Target Background
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
