-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRNPH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-285 of human HNRNPH2 (NP_062543.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HNRNPH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-285 of human HNRNPH2 (NP_062543.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03364A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRNPH2 |
| Target Synonyms | FTP3; MRXSB; NRPH2; HNRPH'; HNRPH2; hnRNPH'; HNRNPH2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-285 of human HNRNPH2 (NP_062543.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQS | Uniprot ID | P55795 |
Uniprot Id
P55795
Target Species
Human
Target Name
HNRNPH2
Target Full Name
Heterogeneous nuclear ribonucleoprotein H2
Target Function
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Binds poly(RG).
Target Involvement
Mental retardation, X-linked, syndromic, Bain type (MRXSB)
Target Subcellular Location
Nucleus, nucleoplasm.
Target Tissue Specificity
Expressed ubiquitously.
Target Research Area
Others
Target Synonyms
FTP 3; FTP-3; FTP3; Heterogeneous nuclear ribonucleoprotein H''; heterogeneous nuclear ribonucleoprotein H2 (H'); Heterogeneous nuclear ribonucleoprotein H2; HNRH2_HUMAN; hnRNP H''; hnRNP H2; hnRNPH'; HNRNPH2; HNRPH'; HNRPH2
Target Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that binds to RNAs. It is very similar to the family member HNRPH1. This gene is thought to be involved in Fabray disease and X-linked agammaglobulinemia phenotype. Alternative splicing results in multiple transcript variants encoding the same protein. Read-through transcription between this locus and the ribosomal protein L36a gene has been observed.
Notification