Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRPLL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HNRPLL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01449A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRPLL |
| Target Synonyms | SRRF; HNRPLL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, DU145, HepG2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS | Uniprot ID | Q8WVV9 |
Uniprot Id
Q8WVV9
Target Species
Human
Target Name
HNRNPLL
Target Full Name
Heterogeneous nuclear ribonucleoprotein L-like
Target Function
RNA-binding protein that functions as regulator of alternative splicing for multiple target mRNAs, including PTPRC/CD45 and STAT5A. Required for alternative splicing of PTPRC.
Target Tissue Specificity
Widely expressed. Detected in bone marrow stroma cells, skeletal muscle, heart, placenta, pancreas, kidney and lung.
Target Synonyms
BLOCK24; Heterogeneous nuclear ribonucleoprotein L like; Heterogeneous nuclear ribonucleoprotein L-like; HNRLL_HUMAN; hnRNPLL; HNRPLL; SRRF; Stromal RNA regulating factor ; Stromal RNA-regulating factor
Target Background
HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer et al., 2008 [PubMed 18669861]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
