Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HP1BP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HP1BP3 (NP_057371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HP1BP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HP1BP3 (NP_057371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06744A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HP1BP3 |
| Target Synonyms | HP1BP74; HP1-BP74; HP1BP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HP1BP3 (NP_057371.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRETPPKSKLAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLSASQLARAQKQTPMASSPRPK | Uniprot ID | Q5SSJ5 |
Uniprot Id
Q5SSJ5
Target Species
Human
Target Name
HP1BP3
Target Full Name
Heterochromatin protein 1-binding protein 3
Target Function
Component of heterochromatin that maintains heterochromatin integrity during G1/S progression and regulates the duration of G1 phase to critically influence cell proliferative capacity. Mediates chromatin condensation during hypoxia, leading to increased tumor cell viability, radio-resistance, chemo-resistance and self-renewal(PubMed:25100860).
Target Subcellular Location
Nucleus. Chromosome.
Target Synonyms
Heterochromatin protein 1; binding protein 3; Heterochromatin protein 1-binding protein 3; HP1 BP74 ; HP1B3_HUMAN; HP1BP 3; HP1BP3; MGC28927; MGC43701; MGC72624; OTTHUMP00000002717; OTTHUMP00000002719; OTTHUMP00000002720; Protein HP1 BP74 ; Protein HP1-BP74; RP5 930J4.3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
