Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSD17B7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human HSD17B7 (NP_057455.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HSD17B7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human HSD17B7 (NP_057455.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03579A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSD17B7 |
| Target Synonyms | PRAP; SDR37C1; HSD17B7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse ovary | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human HSD17B7 (NP_057455.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRKVIHMFSTAEGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYAT | Uniprot ID | P56937 |
Uniprot Id
P56937
Target Species
Human
Target Name
HSD17B7
Target Full Name
3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7
Target Function
Bifunctional enzyme involved in steroid-hormone metabolism and cholesterol biosynthesis. Catalyzes the NADP(H)-dependent reduction of estrogens and androgens and regulates the biological potency of these steroids. Converts estrone (E1) to a more potent estrogen, 17beta-estradiol (E2). Converts dihydrotestosterone (DHT) to its inactive form 5a-androstane-3b,17b-diol. Converts moderately progesterone to 3beta-hydroxypregn-4-ene-20-one, leading to its inactivation. Additionally, participates in the post-squalene cholesterol biosynthesis, as a 3-ketosteroid reductase.; Does not have enzymatic activities toward E1 and DHT.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family, ERG27 subfamily
Target Tissue Specificity
Highly expressed in adrenal gland, liver, lung and thymus. Expressed in breast, ovaries, pituitary gland, pregnant uterus, prostate, kidney, lymph node, small intestine, spinal cord and trachea. Weakly expressed in all other tissues tested.; [Isoform 3]:
Target Synonyms
HSD17B7; 17HSD7; SDR37C1; UNQ2563/PRO6243; 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7; 17-beta-hydroxysteroid dehydrogenase 7; 17-beta-HSD 7; 3-keto-steroid reductase; Dihydrotestosterone oxidoreductase; Estradiol 17-beta-dehydrogenase 7; Short chain dehydrogenase/reductase family 37C member 1
Target Background
HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol (Marijanovic et al., 2003 [PubMed 12829805]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
