Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human HSPB2 (NP_001532.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSPB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human HSPB2 (NP_001532.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00319A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPB2 |
| Target Synonyms | MKBP; HSP27; Hs.78846; LOH11CR1K; HSPB2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human HSPB2 (NP_001532.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP | Uniprot ID | Q16082 |
Uniprot Id
Q16082
Target Species
Human
Target Name
HSPB2
Target Full Name
Heat shock protein beta-2
Target Function
May regulate the kinase DMPK.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Localizes to nuclear foci.
Target Protein Families
Small heat shock protein (HSP20) family
Target Tissue Specificity
Expressed preferentially in skeletal muscle and heart but not in the lens.
Target Research Area
Signal Transduction
Target Synonyms
DMPK-binding protein; Heat shock 27kD protein 2; Heat shock 27kDa protein 2; Heat shock protein beta-2; Heat-shock protein beta-2; Hs.78846; HSP27; HspB2; HSPB2_HUMAN; LOH11CR1K; MGC133245; MKBP
Target Background
The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
