-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HTRA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 334-453 of human HTRA3 (NP_444272.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HTRA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 334-453 of human HTRA3 (NP_444272.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11416A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HTRA3 |
| Target Synonyms | Prsp; Tasp; HTRA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 334-453 of human HTRA3 (NP_444272.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM | Uniprot ID | P83110 |
Uniprot Id
P83110
Target Species
Human
Target Name
HTRA3
Target Full Name
Serine protease HTRA3
Target Function
Serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans. May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization.
Target Subcellular Location
Secreted. Note=Secretion increased during decidualization of endometrial stromal cells.
Target Protein Families
Peptidase S1C family
Target Tissue Specificity
Widely expressed, with highest levels in both adult and fetal heart, ovary, uterus placenta, and bladder. In the endometrium, expressed in epithelial glands and the stroma. Also present in leukocytes. Isoform 1 is predominant in heart and skeletal muscle,
Target Synonyms
High temperature requirement factor A3; High-temperature requirement factor A3; HtrA serine peptidase 3; HTRA3; HTRA3_HUMAN; Pregnancy related serine protease; Pregnancy-related serine protease; Probable serine protease HTRA3; PRSP ; Serine protease HTRA3; Tasp
Target Background
Enables endopeptidase activity; identical protein binding activity; and serine-type peptidase activity. Involved in proteolysis. Predicted to be located in extracellular region.
Notification