-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Human Neurogranin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Human Neurogranin (NP_001119653.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Human Neurogranin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Human Neurogranin (NP_001119653.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07953A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Human Neurogranin |
| Target Synonyms | RC3; hng; Human Neurogranin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Human Neurogranin (NP_001119653.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD | Uniprot ID | Q92686 |
Uniprot Id
Q92686
Target Species
Human
Target Name
NRGN
Target Full Name
Neurogranin
Target Function
Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium.
Target Protein Families
Neurogranin family
Target Tissue Specificity
In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease.
Target Synonyms
Protein kinase C substrate RC3; Calmodulin binding protein; Hng; NEUG(55-78); NEUG_HUMAN; Neurogranin (protein kinase C substrate); Ng; NRGN; Protein kinase C substrate; RC3
Target Background
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Notification