-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HYAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 367-473 of human HYAL2 (NP_149348.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HYAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 367-473 of human HYAL2 (NP_149348.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02924A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HYAL2 |
| Target Synonyms | LUCA2; HYAL2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 367-473 of human HYAL2 (NP_149348.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL | Uniprot ID | Q12891 |
Uniprot Id
Q12891
Target Species
Human
Target Name
HYAL2
Target Full Name
Hyaluronidase-2
Target Function
Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product which is further hydrolyzed by sperm hyaluronidase to give small oligosaccharides. Displays very low levels of activity. Associates with and negatively regulates MST1R.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Glycosyl hydrolase 56 family
Target Tissue Specificity
Widely expressed. No expression detected in adult brain.
Target Research Area
Cancer
Target Synonyms
Hyal 2; Hyal-2; Hyal2; HYAL2_HUMAN; Hyaluronidase 2; Hyaluronidase 2 Precursor; Hyaluronidase-2; Hyaluronoglucosaminidase 2; Hyaluronoglucosaminidase-2; LUCA 2; LUCA-2; LUCA2; Lung carcinoma protein 2; lysosomal hyaluronidase; PH 20 homolog; PH-20 homolog; PH20 homolog
Target Background
This gene encodes a weak acid-active hyaluronidase. The encoded protein is similar in structure to other more active hyaluronidases. Hyaluronidases degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan and fragments of hyaluronan are thought to be involved in cell proliferation, migration and differentiation. Although it was previously thought to be a lysosomal hyaluronidase that is active at a pH below 4, the encoded protein is likely a GPI-anchored cell surface protein. This hyaluronidase serves as a receptor for the oncogenic virus Jaagsiekte sheep retrovirus. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. This gene encodes two alternatively spliced transcript variants which differ only in the 5' UTR.
Notification