Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ICA1 (NP_001263407) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ICA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ICA1 (NP_001263407) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06898A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICA1 |
| Target Synonyms | ICA69; ICAp69; ICA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ICA1 (NP_001263407). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQ | Uniprot ID | Q05084 |
Uniprot Id
Q05084
Target Species
Human
Target Name
ICA1
Target Full Name
Islet cell autoantigen 1
Target Function
May play a role in neurotransmitter secretion.
Target Subcellular Location
Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein. Note=Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
Target Tissue Specificity
Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Target Research Area
Neuroscience
Target Synonyms
69 kDa islet cell autoantigen; Diabetes mellitus type I autoantigen; ICA 1; Ica1; ICA69; ICA69_HUMAN; ICAp69; Islet cell autoantigen 1 (69kD); Islet cell autoantigen 1 69kDa; Islet cell autoantigen 1; Islet cell autoantigen 1 isoform; Islet cell autoantigen p69; OTTHUMP00000200933; OTTHUMP00000200934; OTTHUMP00000200941; OTTHUMP00000200993; p69
Target Background
This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
