-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICAM-1/CD54 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
The antibody against ICAM-1/CD54 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
| Cat.No | ADA-16770A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICAM-1/CD54 |
| Target Synonyms | BB2; CD54; P3.58; MALA2; MyD10; ICAM-1/CD54 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, FC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ | Uniprot ID | P05362 |
Uniprot Id
P05362
Target Species
Human
Target Name
ICAM1
Target Full Name
Intercellular adhesion molecule 1
Target Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins.; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins.; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, ICAM family
Target Research Area
Cell Adhesion
Target Synonyms
Antigen identified by monoclonal BB2; BB 2; BB2; CD 54; CD_antigen=CD54; CD54; Cell surface glycoprotein P3.58 ; Human rhinovirus receptor; ICAM 1; ICAM-1; ICAM1; ICAM1_HUMAN; intercellular adhesion molecule 1 (CD54); intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; Intercellular adhesion molecule 1; Major group rhinovirus receptor; MALA 2; MALA2; MyD 10; MyD10; P3.58; Surface antigen of activated B cells; Surface antigen of activated B cells, BB2
Target Background
This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.
Notification