Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICAM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human ICAM4 (NP_001034221.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ICAM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human ICAM4 (NP_001034221.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02508A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICAM4 |
| Target Synonyms | LW; CD242; ICAM4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, HepG2, Jurkat, Mouse brain, Mouse pancreas, Mouse spleen, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human ICAM4 (NP_001034221.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG | Uniprot ID | Q14773 |
Uniprot Id
Q14773
Target Species
Human
Target Name
ICAM4
Target Full Name
Intercellular adhesion molecule 4
Target Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.
Target Subcellular Location
[Isoform Long]: Cell membrane; Single-pass type I membrane protein.; [Isoform Short]: Secreted.; Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, ICAM family
Target Tissue Specificity
Erythrocytes.
Target Synonyms
CD242; CD242 antigen ; ICAM-4; Icam4; ICAM4_HUMAN; Intercellular adhesion molecule 4; Landsteiner Wiener blood group glycoprotein; Landsteiner-Wiener blood group glycoprotein; LW; LW blood group protein
Target Background
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
