Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-284 of human ICMT (NP_036537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ICMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-284 of human ICMT (NP_036537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09034A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICMT |
| Target Synonyms | PCMT; PPMT; PCCMT; HSTE14; MST098; MSTP098; ICMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse lung, Mouse testis, Rat testis, THP-1, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 175-284 of human ICMT (NP_036537.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL | Uniprot ID | O60725 |
Uniprot Id
O60725
Target Species
Human
Target Name
ICMT
Target Full Name
Protein-S-isoprenylcysteine O-methyltransferase
Target Function
Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Class VI-like SAM-binding methyltransferase superfamily, Isoprenylcysteine carboxyl methyltransferase family
Target Tissue Specificity
Ubiquitously expressed. Expressed at higher levels in the cerebellum and putamen than in other brain regions. Abundant expression seen in the Purkinje cells and pontine neurons.
Target Synonyms
1700008E11Rik; C80758; fcmt; Gm13095; HSTE14; Icmt; ICMT_HUMAN; Isoprenylcysteine carboxylmethyltransferase; MGC118506; MGC39955 ; MGC95322; MST098; MSTP098; OTTMUSG00000010406; pcCMT; PCMT; PPMT; Prenylated protein carboxyl methyltransferase; Prenylcysteine carboxyl methyltransferase; Protein-S-isoprenylcysteine O-methyltransferase; RP23-421E12.4; STE14
Target Background
This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
