Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-206 of human ICT1 (NP_001536.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ICT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-206 of human ICT1 (NP_001536.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01976A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICT1 |
| Target Synonyms | DS1; DS-1; ICT1; MRP-L58 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, B cells, HT-29, Mouse brain, Mouse lung, Raji, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-206 of human ICT1 (NP_001536.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD | Uniprot ID | Q14197 |
Uniprot Id
Q14197
Target Species
Human
Target Name
MRPL58
Target Full Name
Large ribosomal subunit protein mL62
Target Function
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily
Target Tissue Specificity
Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.
Target Research Area
Metabolism
Target Synonyms
Digestion substraction 1; DS-1; DS1; Ict1; ICT1_HUMAN; Immature colon carcinoma transcript 1; Immature colon carcinoma transcript 1 protein; mitochondrial; Peptidyl-tRNA hydrolase ICT1; Peptidyl-tRNA hydrolase ICT1, mitochondrial
Target Background
The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
