-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ID3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human ID3 (NP_002158.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against ID3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human ID3 (NP_002158.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08624A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ID3 |
| Target Synonyms | HEIR-1; bHLHb25; ID3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human ID3 (NP_002158.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH | Uniprot ID | Q02535 |
Uniprot Id
Q02535
Target Species
Human
Target Name
ID3
Target Full Name
DNA-binding protein inhibitor ID-3
Target Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
Target Synonyms
1R21; bHLHb25; Class B basic helix-loop-helix protein 25; DNA binding protein inhibitor ID 3; DNA-binding protein inhibitor ID-3; HEIR 1; HEIR1; Helix loop helix protein HEIR 1; Helix loop helix protein HEIR1 ; Helix-loop-helix protein HEIR-1; HLH642; ID 3; ID like protein inhibitor HLH 1R21 ; ID like protein inhibitor HLH 462 ; ID-like protein inhibitor HLH 1R21; ID3; ID3_HUMAN; Inhibitor of DNA binding 3; Inhibitor of DNA binding 3 dominant negative helix loop helix protein
Target Background
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
Notification