-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human IDH1 (NP_005887.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IDH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human IDH1 (NP_005887.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13941A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDH1 |
| Target Synonyms | IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26; IDH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Hep G2, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IDH1 (NP_005887.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA | Uniprot ID | O75874 |
Uniprot Id
O75874
Target Species
Human
Target Name
IDH1
Target Full Name
Isocitrate dehydrogenase [NADP] cytoplasmic
Target Involvement
Glioma (GLM)
Target Subcellular Location
Cytoplasm, cytosol. Peroxisome.
Target Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Target Research Area
Cancer
Target Synonyms
Cytosolic NADP isocitrate dehydrogenase; Cytosolic NADP-isocitrate dehydrogenase; Epididymis luminal protein 216; Epididymis secretory protein Li 26; HEL-216; HEL-S-26; ICDH; IDCD; IDH; IDH1; IDHC_HUMAN; IDP; IDPC; Isocitrate dehydrogenase (NADP(+)) 1 cytosolic; Isocitrate dehydrogenase [NADP] cytoplasmic; Isocitrate dehydrogenase 1 (NADP+) soluble; NADP dependent isocitrate dehydrogenase cytosolic; NADP dependent isocitrate dehydrogenase peroxisomal; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; PICD
Target Background
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Notification