-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 353-452 of human IDH2 (P48735) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 353-452 of human IDH2 (P48735) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15807A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDH2 |
| Target Synonyms | IDH; IDP; IDHM; IDPM; ICD-M; IDH-2; D2HGA2; mNADP-IDH; IDH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, K-562, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 353-452 of human IDH2 (P48735). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ | Uniprot ID | P48735 |
Uniprot Id
P48735
Target Species
Human
Target Name
IDH2
Target Full Name
Isocitrate dehydrogenase [NADP], mitochondrial
Target Function
Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
Target Involvement
D-2-hydroxyglutaric aciduria 2 (D2HGA2); Glioma (GLM)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Target Synonyms
D2HGA2; ICD-M; IDH; IDH2; IDHM; IDHP_HUMAN; IDP; IDPM; Isocitrate dehydrogenase [NADP], mitochondrial; Isocitrate dehydrogenase 2 (NADP+), mitochondrial; mNADP-IDH; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase
Target Background
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants.
Notification