-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDH3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IDH3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06070A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDH3B |
| Target Synonyms | RP46; IDH3B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 293T, NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE | Uniprot ID | O43837 |
Uniprot Id
O43837
Target Species
Human
Target Name
IDH3B
Target Full Name
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
Target Function
Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
Target Involvement
Retinitis pigmentosa 46 (RP46)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Target Research Area
Metabolism
Target Synonyms
FLJ11043; H-IDHB; Idh3B; IDH3B_HUMAN; Isocitrate dehydrogenase [NAD] subunit beta; Isocitrate dehydrogenase [NAD] subunit beta; mitochondrial ; isocitrate dehydrogenase 3; beta subunit ; Isocitric dehydrogenase; Isocitric dehydrogenase subunit beta; MGC903; mitochondrial; NAD(+)-specific ICDH; NAD(+)-specific ICDH subunit beta; NAD+-specific isocitrate dehydrogenase b subunit ; NAD+-specific isocitrate dehydrogenase beta ; OTTHUMP00000030023; OTTHUMP00000030024; RP46
Target Background
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification