-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IDO1 (P14902) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against IDO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IDO1 (P14902) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-13426A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDO1 |
| Target Synonyms | IDO; INDO; IDO-1; IDO1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary | Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IDO1 (P14902). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDV | Uniprot ID | P14902 |
Uniprot Id
P14902
Target Species
Human
Target Name
IDO1
Target Full Name
Indoleamine 2,3-dioxygenase 1
Target Function
Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway. Involved in the peripheral immune tolerance, contributing to maintain homeostasis by preventing autoimmunity or immunopathology that would result from uncontrolled and overreacting immune responses. Tryptophan shortage inhibits T lymphocytes division and accumulation of tryptophan catabolites induces T-cell apoptosis and differentiation of regulatory T-cells. Acts as a suppressor of anti-tumor immunity. Limits the growth of intracellular pathogens by depriving tryptophan. Protects the fetus from maternal immune rejection.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Indoleamine 2,3-dioxygenase family
Target Tissue Specificity
Expressed in mature dendritic cells located in lymphoid organs (including lymph nodes, spleen, tonsils, Peyers's patches, the gut lamina propria, and the thymic medulla), in some epithelial cells of the female genital tract, as well as in endothelial cell
Target Research Area
Cardiovascular
Target Synonyms
3-dioxygenase; I23O1_HUMAN; IDO 1; IDO; IDO-1; IDO1; INDO; indolamine 2,3 dioxygenase; Indole 2 3 dioxygenase; indoleamine 2 3 dioxygenase 1; indoleamine 2 3 dioxygenase; Indoleamine 2,3-dioxygenase 1; Indoleamine pyrrole 2 3 dioxygenase ; Indoleamine-pyrrole 2
Target Background
This gene encodes indoleamine 2, 3-dioxygenase (IDO) - a heme enzyme that catalyzes the first and rate-limiting step in tryptophan catabolism to N-formyl-kynurenine. This enzyme acts on multiple tryptophan substrates including D-tryptophan, L-tryptophan, 5-hydroxy-tryptophan, tryptamine, and serotonin. This enzyme is thought to play a role in a variety of pathophysiological processes such as antimicrobial and antitumor defense, neuropathology, immunoregulation, and antioxidant activity. Through its expression in dendritic cells, monocytes, and macrophages this enzyme modulates T-cell behavior by its peri-cellular catabolization of the essential amino acid tryptophan.
Notification