-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFNGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 221-322 of human IFNGR2 (NP_005525.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFNGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 221-322 of human IFNGR2 (NP_005525.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05789A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFNGR2 |
| Target Synonyms | AF-1; IFGR2; IMD28; IFNGT1; IFNGR2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A-549, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 221-322 of human IFNGR2 (NP_005525.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSI | Uniprot ID | P38484 |
Uniprot Id
P38484
Target Species
Human
Target Name
IFNGR2
Target Full Name
Interferon gamma receptor 2
Target Function
Associates with IFNGR1 to form a receptor for the cytokine interferon gamma (IFNG). Ligand binding stimulates activation of the JAK/STAT signaling pathway. Required for signal transduction in contrast to other receptor subunit responsible for ligand binding.
Target Involvement
Immunodeficiency 28 (IMD28)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Cytoplasm.
Target Protein Families
Type II cytokine receptor family
Target Tissue Specificity
Expressed in T-cells (at protein level).
Target Synonyms
IFNGR2; IFNGT1; Interferon gamma receptor 2; IFN-gamma receptor 2; IFN-gamma-R2; Interferon gamma receptor accessory factor 1; AF-1; Interferon gamma receptor beta-chain; IFN-gamma-R-beta; Interferon gamma transducer 1
Target Background
This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
Notification