Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGFL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human IGFL3 (NP_997276.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IGFL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human IGFL3 (NP_997276.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02653A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGFL3 |
| Target Synonyms | UNQ483; IGFL3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human IGFL3 (NP_997276.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCGSTCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLYP | Uniprot ID | Q6UXB1 |
Uniprot Id
Q6UXB1
Target Species
Human
Target Name
IGFL3
Target Full Name
Insulin growth factor-like family member 3
Target Function
Potential ligand of the IGFLR1 cell membrane receptor.
Target Subcellular Location
Secreted.
Target Protein Families
IGFL family
Target Tissue Specificity
Detected in the cerebellum.
Target Synonyms
IGF like family member 3; IGFL3; IGFL3_HUMAN; Insulin growth factor-like family member 3; RPRC483; UNQ483
Target Background
IGFL3 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
