Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGSF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human IGSF11 (NP_689751.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IGSF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human IGSF11 (NP_689751.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07131A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGSF11 |
| Target Synonyms | CT119; VSIG3; BTIGSF; Igsf13; BT-IgSF; CXADRL1; IGSF11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human IGSF11 (NP_689751.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVT | Uniprot ID | Q5DX21 |
Uniprot Id
Q5DX21
Target Species
Human
Target Name
IGSF11
Target Full Name
Immunoglobulin superfamily member 11
Target Function
Functions as a cell adhesion molecule through homophilic interaction. Stimulates cell growth.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Abundantly expressed in testis and ovary and to a lower extent in brain, kidney and skeletal muscle.
Target Synonyms
IGSF11; BTIGSF; CXADRL1; VSIG3; Immunoglobulin superfamily member 11; IgSF11; Brain and testis-specific immunoglobulin superfamily protein; Bt-IGSF; V-set and immunoglobulin domain-containing protein 3
Target Background
IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
