-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ikaros was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA, CUT&Tag.
The antibody against Ikaros was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA, CUT&Tag.
| Cat.No | ADA-14096A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ikaros |
| Target Synonyms | IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452; Ikaros | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, U-937 | Application | ELISA, WB, ChIP, CUT&Tag, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL | Uniprot ID | Q13422 |
Uniprot Id
Q13422
Target Species
Human
Target Name
IKZF1
Target Full Name
DNA-binding protein Ikaros
Target Function
Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms.
Target Involvement
Immunodeficiency, common variable, 13 (CVID13)
Target Subcellular Location
Nucleus.; [Isoform Ik2]: Nucleus.; [Isoform Ik6]: Cytoplasm.
Target Protein Families
Ikaros C2H2-type zinc-finger protein family
Target Tissue Specificity
Abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. Lower expression in bone marrow and small intestine.
Target Research Area
Cancer
Target Synonyms
CLL associated antigen KW 6; DNA-binding protein Ikaros; hIk 1; Hs.54452; IK1; Ikaros (zinc finger protein); IKAROS; IKAROS family zinc finger 1 (Ikaros); Ikaros family zinc finger protein 1; Ikzf1; IKZF1_HUMAN; LYF1; Lymphoid transcription factor LyF-1; PRO0758; Zinc finger protein subfamily 1A 1 (Ikaros); Zinc finger protein subfamily 1A 1; Zinc finger protein; subfamily 1A; member 1; ZNFN1A1
Target Background
This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors. Overexpression of some dominant-negative isoforms have been associated with B-cell malignancies, such as acute lymphoblastic leukemia (ALL).
Notification