-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL-1RAcP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL-1RAcP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14854A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL-1RAcP |
| Target Synonyms | IL1R3; C3orf13; IL-1RAcP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Karpas 299, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSP | Uniprot ID | Q9NPH3 |
Uniprot Id
Q9NPH3
Target Species
Human
Target Name
IL1RAP
Target Full Name
Interleukin-1 receptor accessory protein
Target Function
Coreceptor for IL1RL2 in the IL-36 signaling system. Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Coreceptor for IL1RL1 in the IL-33 signaling system. Can bidirectionally induce pre- and postsynaptic differentiation of neurons by trans-synaptically binding to PTPRD. May play a role in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (Probable).; Associates with secreted ligand-bound IL1R2 and increases the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Enhances the ability of secreted IL1R1 to inhibit IL-33 signaling.; Unable to mediate canonical IL-1 signaling. Required for Src phosphorylation by IL1B. May be involved in IL1B-potentiated NMDA-induced calcium influx in neurons.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.
Target Protein Families
Interleukin-1 receptor family
Target Tissue Specificity
Detected in liver, skin, placenta, thymus and lung. Isoform 4 is predominantly expressed in brain. Overexpressed on candidate chronic myeloid leukemia (CML) stem cells, hematopoietic stem cells and mononuclear cells of patients with acute myeloid leukemia
Target Synonyms
C3orf13; FLJ37788; IL 1 receptor accessory protein; IL 1R 3; IL 1R3; IL 1RAcP; IL 1RAP; IL-1 receptor accessory protein; IL-1R-3; IL-1R3; IL-1RAcP; IL-1RAP; IL1 receptor accessory protein; IL1AP_HUMAN; IL1R3; IL1RAcP; Il1rap; Interleukin 1 Accessory Protein; interleukin 1 receptor 3; Interleukin 1 receptor accessory protein; interleukin 1 receptor accessory protein beta; Interleukin-1 receptor 3; Interleukin-1 receptor accessory protein
Target Background
This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress.
Notification