Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-146 of human IL13 (NP_002179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-146 of human IL13 (NP_002179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07964A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL13 |
| Target Synonyms | P600; IL-13; [KD Validated] IL13 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-146 of human IL13 (NP_002179.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN | Uniprot ID | P35225 |
Uniprot Id
P35225
Target Species
Human
Target Name
IL13
Target Full Name
Interleukin-13
Target Function
Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Target Involvement
Allergic rhinitis (ALRH)
Target Subcellular Location
Secreted.
Target Protein Families
IL-4/IL-13 family
Target Research Area
Immunology, Cytokine
Target Synonyms
Allergic rhinitis; ALRH; BHR 1; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; IL-13; Il13; IL13_HUMAN; Interleukin 13; Interleukin-13; interleukin13; MGC116786; MGC116788; MGC116789; NC 30; NC30; P 600; P600
Target Background
This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
