Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL13RA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL13RA2 (NP_000631.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL13RA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL13RA2 (NP_000631.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04301A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL13RA2 |
| Target Synonyms | CT19; IL-13R; IL13BP; CD213A2; IL13RA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, PC-3, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL13RA2 (NP_000631.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW | Uniprot ID | Q14627 |
Uniprot Id
Q14627
Target Species
Human
Target Name
IL13RA2
Target Full Name
Interleukin-13 receptor subunit alpha-2
Target Function
Binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4).
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 5 subfamily
Target Synonyms
Cancer/testis antigen 19; CD213a2; CT19; I13R2_HUMAN; IL-13 receptor subunit alpha-2; IL-13R subunit alpha-2; IL-13R-alpha-2; IL-13RA2; IL13 receptor; IL13BP; IL13R; Il13ra2; Interleukin 13 binding protein; Interleukin 13 receptor alpha 2 chain; Interleukin-13 receptor subunit alpha-2; Interleukin-13-binding protein
Target Background
The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
