-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL1F10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human IL1F10 (NP_115945.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL1F10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human IL1F10 (NP_115945.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09585A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL1F10 |
| Target Synonyms | IL-38; FKSG75; IL1HY2; IL-1HY2; IL1-theta; FIL1-theta; IL1F10 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human IL1F10 (NP_115945.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW | Uniprot ID | Q8WWZ1 |
Uniprot Id
Q8WWZ1
Target Species
Human
Target Name
IL1F10
Target Full Name
Interleukin-1 family member 10
Target Function
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.
Target Subcellular Location
Cytoplasm. Secreted.
Target Protein Families
IL-1 family
Target Tissue Specificity
Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
Target Research Area
Immunology
Target Synonyms
family of interleukin 1-theta; FIL1 theta; FIL1T; FKSG75; IL 38; IL-1 theta; IL-1F10 (canonical form IL-1F10a); IL-1F10; IL-1HY2; IL1 theta; IL1F10; IL1FA_HUMAN; IL1HY2; Interleukin 1 family member 10 (theta); Interleukin 1 receptor antagonist FKSG75; Interleukin 1 receptor antagonist homolog 2; Interleukin 1 receptor antagonist like FIL1 theta; Interleukin-1 family member 10; Interleukin-1 HY2; Interleukin-1 theta; interleukin-38
Target Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. Two alternatively spliced transcript variants encoding the same protein have been reported.
Notification