Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IL22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11119A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL22 |
| Target Synonyms | TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23; IL22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI | Uniprot ID | Q9GZX6 |
Uniprot Id
Q9GZX6
Target Species
Human
Target Name
IL22
Target Full Name
Interleukin-22
Target Function
Cytokine that contributes to the inflammatory response in vivo.
Target Subcellular Location
Secreted.
Target Protein Families
IL-10 family
Target Synonyms
Cytokine Zcyto18; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; IL-10-related T-cell-derived-inducible factor; IL-22; IL-TIF; IL21; Il22; IL22_HUMAN; ILD110; ILTIF; Interleukin 10 related T cell derived inducible factor; interleukin 21; Interleukin 22; Interleukin-22; MGC79382; MGC79384; TIFa; TIFIL 23; TIFIL23; UNQ3099/PRO10096; zcyto18
Target Background
This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
