-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL23R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-629 of human IL23R (NP_653302.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IL23R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-629 of human IL23R (NP_653302.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14945A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL23R |
| Target Synonyms | PSORS7; IL23R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse thymus, Raji, RAW264.7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-629 of human IL23R (NP_653302.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPPVDSLDSGNNPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK | Uniprot ID | Q5VWK5 |
Uniprot Id
Q5VWK5
Target Species
Human
Target Name
IL23R
Target Full Name
Interleukin-23 receptor
Target Function
Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in innate and adaptive immunity and may participate in acute response to infection in peripheral tissues. IL23 may be responsible for autoimmune inflammatory diseases and be important for tumorigenesis.
Target Involvement
Inflammatory bowel disease 17 (IBD17)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 2 subfamily
Target Tissue Specificity
Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells.
Target Synonyms
IL 23R; IL-23 receptor; IL-23R; IL23 Receptor; Il23r; IL23R_HUMAN; Interleukin 23 receptor ; Interleukin-23 receptor
Target Background
The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), and also binds to transcription activator STAT3 in a ligand-dependent manner.
Notification