Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-177 of human IL25 (NP_073626.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IL25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-177 of human IL25 (NP_073626.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01569A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL25 |
| Target Synonyms | IL17E; IL25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with 17E/IL25 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 33-177 of human IL25 (NP_073626.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG | Uniprot ID | Q9H293 |
Uniprot Id
Q9H293
Target Species
Human
Target Name
IL25
Target Full Name
Interleukin-25
Target Function
Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
Target Subcellular Location
Secreted.
Target Protein Families
IL-17 family
Target Tissue Specificity
Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
Target Synonyms
IL 17E; IL 25; IL-17E; IL-25; IL17e; IL25; IL25_HUMAN; Interleukin 17E ; Interleukin 25 ; Interleukin-17E; Interleukin-25; Interleukin17E; Interleukin25; OTTHUMP00000027946; OTTHUMP00000246238; UNQ3120/PRO10272
Target Background
The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
