-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL2RB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL2RB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03139A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL2RB |
| Target Synonyms | CD122; IMD63; IL15RB; P70-75; IL2RB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Raji, RAW264.7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFS | Uniprot ID | P14784 |
Uniprot Id
P14784
Target Species
Human
Target Name
IL2RB
Target Full Name
Interleukin-2 receptor subunit beta
Target Function
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 4 subfamily
Target Synonyms
IL2RB; IL15RB; Interleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; Interleukin-15 receptor subunit beta; p70-75; p75; CD antigen CD122
Target Background
The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. The use of alternative promoters results in multiple transcript variants encoding the same protein. The protein is primarily expressed in the hematopoietic system. The use by some variants of an alternate promoter in an upstream long terminal repeat (LTR) results in placenta-specific expression.
Notification