-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL4I1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL4I1 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL4I1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL4I1 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15138A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL4I1 |
| Target Synonyms | LAO; FIG1; LAAO; hIL4I1; IL4I1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL4I1. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFT | Uniprot ID | Q96RQ9 |
Uniprot Id
Q96RQ9
Target Species
Human
Target Name
IL4I1
Target Full Name
L-amino-acid oxidase
Target Function
Secreted L-amino-acid oxidase that acts as a key immunoregulator. Has preference for L-aromatic amino acids: converts phenylalanine (Phe), tyrosine (Tyr) and tryptophan (Trp) to phenylpyruvic acid (PP), hydroxyphenylpyruvic acid (HPP), and indole-3-pyruvic acid (I3P), respectively. Also has weak L-arginine oxidase activity. Acts as a negative regulator of anti-tumor immunity by mediating Trp degradation via an indole pyruvate pathway that activates the transcription factor AHR. IL4I1-mediated Trp catabolism generates I3P, giving rise to indole metabolites (indole-3-acetic acid (IAA) and indole-3-aldehyde (I3A)) and kynurenic acid, which act as ligands for AHR, a ligand-activated transcription factor that plays important roles in immunity and cancer. AHR activation by indoles following IL4I1-mediated Trp degradation enhances tumor progression by promoting cancer cell motility and suppressing adaptive immunity. Also has an immunoregulatory function in some immune cells, probably by mediating Trp degradation and promoting downstream AHR activation: inhibits T-cell activation and proliferation, promotes the differentiation of naive CD4(+) T-cells into FOXP3(+) regulatory T-cells (Treg) and regulates the development and function of B-cells. Also regulates M2 macrophage polarization by inhibiting T-cell activation. Also has antibacterial properties by inhibiting growth of Gram negative and Gram positive bacteria through the production of NH4(+) and H2O2.
Target Subcellular Location
Secreted. Lysosome. Cytoplasmic vesicle, secretory vesicle, acrosome.
Target Protein Families
Flavin monoamine oxidase family, FIG1 subfamily
Target Tissue Specificity
Primarily found in immune tissues, with the highest expression in lymph nodes and spleen. Present in germinal center macrophages and inflammatory myeloid cells and antigen-presenting cells (at protein level). Also present in spermatozoa (at protein level)
Target Research Area
Cell Biology
Target Synonyms
IL4I1; FIG1; UNQ636/PRO1265; L-amino-acid oxidase; LAAO; LAO; EC 1.4.3.2; Interleukin-4-induced protein 1; IL4-induced protein 1; Protein Fig-1; hFIG1
Target Background
This gene encodes a secreted L-amino acid oxidase protein which primarily catabolizes L-phenylalanine and, to a lesser extent, L-arginine. The expression of this gene is induced by the cytokine interleukin 4 in B cells. This gene is also expressed in macrophages and dendritic cells. This protein may play a role immune system escape as it is expressed in tumor-associated macrophages and suppresses T-cell responses. This protein also contains domains thought to be involved in the binding of flavin adenine dinucleotide (FAD) cofactor. Multiple transcript variants encoding different isoforms have been found for this gene. Some transcripts of this gene share a promoter and exons of the 5' UTR with the overlapping NUP62 gene.
Notification