-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-99 of human IL8(NP_000575.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.
The antibody against IL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-99 of human IL8(NP_000575.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.
| Cat.No | ADA-15563A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL8 |
| Target Synonyms | IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant Human IL-8 Protein, THP-1 treated by PMA/TPA and LPS | Application | ELISA, WB, FC, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-99 of human IL8(NP_000575.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS | Uniprot ID | P10145 |
Uniprot Id
P10145
Target Species
Human
Target Name
CXCL8
Target Full Name
Interleukin-8
Target Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Research Area
Immunology
Target Synonyms
(Ala-IL-8)77; (Ser-IL-8)72; 9E3; Beta thromboglobulin like protein; C-X-C motif chemokine 8; CEF-4; chemokine; CXC motif; ligand 8; CXCL8; Emoctakin; GCP-1; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; Granulocyte chemotactic protein 1; IL-8; IL-8(1-77); IL-8(9-77); IL8; IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; IL8_HUMAN; Inteleukin 8; LECT; LUCT; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-b; MDNCF-c; MONAP; Monocyte derived neutrophil activating peptide; Monocyte derived neutrophil chemotactic factor; Monocyte-derived neutrophil chemotactic factor; Monocyte-derived neutrophil-activating peptide; NAF; NAP 1; NAP-1; NAP1; Neutrophil activating peptide 1; Neutrophil activating protein 1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3 10C; Protein 3-10C; SCYB 8; SCYB8; Small inducible cytokine subfamily B member 8; T cell chemotactic factor ; T-cell chemotactic factor; TSG 1; TSG1
Target Background
The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.
Notification