Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ILVBL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 503-632 of human ILVBL (NP_006835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ILVBL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 503-632 of human ILVBL (NP_006835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ILVBL |
| Target Synonyms | AHAS; 209L8; ILV2H; HACL1L; ILVBL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, BxPC-3, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 503-632 of human ILVBL (NP_006835.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKVLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV | Uniprot ID | A1L0T0 |
Uniprot Id
A1L0T0
Target Species
Human
Target Name
ILVBL
Target Full Name
2-hydroxyacyl-CoA lyase 2
Target Function
Endoplasmic reticulum 2-OH acyl-CoA lyase involved in the cleavage (C1 removal) reaction in the fatty acid alpha-oxydation in a thiamine pyrophosphate (TPP)-dependent manner. Involved in the phytosphingosine degradation pathway.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
TPP enzyme family
Target Tissue Specificity
Expressed in all tissues tested, with highest expression in heart, pancreas and placenta.
Target Synonyms
ILVBL; AHAS; HACL2; 2-hydroxyacyl-CoA lyase 2; Acetolactate synthase-like protein; IlvB-like protein
Target Background
The protein encoded by this gene shares similarity with several thiamine pyrophosphate-binding proteins identified in bacteria, yeast, and plants. The highest degree of similarity is found with bacterial acetolactate synthases (AHAS), which are enzymes that catalyze the first step in branched-chain amino acid biosynthesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
