-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ING2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human ING2 (NP_001555.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ING2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human ING2 (NP_001555.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ING2 |
| Target Synonyms | ING1L; p33ING2; ING2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, MCF7, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human ING2 (NP_001555.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKE | Uniprot ID | Q9H160 |
Uniprot Id
Q9H160
Target Species
Human
Target Name
ING2
Target Full Name
Inhibitor of growth protein 2
Target Function
Seems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs).
Target Subcellular Location
Nucleus. Note=Predominantly nuclear. Localized to chromatin and nuclear matrix. Upon reduced PtdIns(5)P levels seems to be released from chromatin and, at least partially, translocated to the cytoplasm.
Target Protein Families
ING family
Target Tissue Specificity
Widely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues.
Target Synonyms
ING 1 like tumor suppressor protein; ING 1L; ING 2; ING1 like tumor suppressor protein; ING1L; ING1Lp; ING2; ING2_HUMAN; Inhibitor of growth 1 like; Inhibitor of growth 1 like protein; Inhibitor of growth 1-like protein; Inhibitor of growth family member 1 like; Inhibitor of growth family member 2; Inhibitor of growth protein 2; p32; p33 ING2; p33ING2
Target Background
This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants.
Notification