-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ING3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human ING3 (NP_938008.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ING3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human ING3 (NP_938008.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ING3 |
| Target Synonyms | Eaf4; ING2; MEAF4; p47ING3; ING3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Rat testis, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human ING3 (NP_938008.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF | Uniprot ID | Q9NXR8 |
Uniprot Id
Q9NXR8
Target Species
Human
Target Name
ING3
Target Full Name
Inhibitor of growth protein 3
Target Function
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome.
Target Involvement
Squamous cell carcinoma of the head and neck (HNSCC)
Target Subcellular Location
Nucleus.
Target Protein Families
ING family
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus.
Target Synonyms
ING3; HSPC301; Inhibitor of growth protein 3; p47ING3
Target Background
The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.
Notification