-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against iNOS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-200 of human iNOS (P35228) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against iNOS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-200 of human iNOS (P35228) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17082A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | iNOS |
| Target Synonyms | NOS; INOS; NOS2A; HEP-NOS; iNOS | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW 264.7+LPS | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-200 of human iNOS (P35228). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC | Uniprot ID | P35228 |
Uniprot Id
P35228
Target Species
Human
Target Name
NOS2
Target Full Name
Nitric oxide synthase, inducible
Target Function
Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM. Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
NOS family
Target Tissue Specificity
Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets.
Target Research Area
Cancer
Target Synonyms
HEP-NOS; Hepatocyte NOS; HEPNOS ; inducible; Inducible nitric oxide synthase ; Inducible NO synthase; Inducible NOS; iNOS; MAC NOS; Macrophage NOS; Nitric oxide synthase 2 inducible; Nitric oxide synthase 2 inducible macrophage ; nitric oxide synthase 2A (inducible, hepatocytes); Nitric oxide synthase; Nitric oxide synthase inducible ; nitric oxide synthase, macrophage; NOS 2; NOS; Nos II; NOS type II; nos2; NOS2_HUMAN; NOS2A; NOS2A, Inducible, Hepatocyte; Peptidyl-cysteine S-nitrosylase NOS2
Target Background
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
Notification