-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Integrin alpha 2 (ITGA2/CD49b) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Integrin alpha 2 (ITGA2/CD49b) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-17173A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Integrin alpha 2 (ITGA2/CD49b) |
| Target Synonyms | BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; b) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A549, Mouse large intestine, Mouse lung, Mouse spleen, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS | Uniprot ID | P17301 |
Uniprot Id
P17301
Target Species
Human
Target Name
ITGA2
Target Full Name
Integrin alpha-2
Target Function
Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix.; (Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human rotavirus A.; (Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human echoviruses 1 and 8.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Research Area
Signal Transduction
Target Synonyms
BR; CD 49b; CD49 antigen like family member B; CD49 antigen-like family member B; CD49b; CD49b antigen; Collagen receptor; DX5; Glycoprotein Ia deficiency included; GP Ia; GP Ia deficiency; included; GPIa; HPA 5 included; HPA5 included; Human platelet alloantigen system 5; Integrin alpha 2; Integrin alpha II; Integrin alpha-2; Integrin; alpha 2 (CD49B alpha 2 subunit of VLA 2 receptor); ITA2_HUMAN; ITGA2; Platelet alloantigen Br(a); included; Platelet antigen Br; Platelet glycoprotein GPIa; Platelet glycoprotein Ia; Platelet glycoprotein Ia/IIa; Platelet membrane glycoprotein Ia; Platelet receptor for collagen; deficiency of; included; Very late activation protein 2 receptor alpha 2 subunit; VLA 2 alpha chain; VLA 2; VLA 2 subunit alpha; VLA-2 subunit alpha; VLA2; VLA2 receptor alpha 2 subunit; VLAA2
Target Background
This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants.
Notification