-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Integrin alpha 5 (ITGA5/CD49e) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
The antibody against Integrin alpha 5 (ITGA5/CD49e) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
| Cat.No | ADA-16765A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Integrin alpha 5 (ITGA5/CD49e) |
| Target Synonyms | FNRA; CD49e; VLA-5; VLA5A; Integrin alpha 5 (ITGA5/CD49e) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, Rat heart, A-549, Mouse large intestine, Mouse liver, Mouse lung, Mouse spleen, Rat liver, Rat lung, U-937 | Application | ELISA, WB, FC, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA | Uniprot ID | P08648 |
Uniprot Id
P08648
Target Species
Human
Target Name
ITGA5
Target Full Name
Integrin alpha-5
Target Function
Integrin alpha-5/beta-1 (ITGA5:ITGB1) is a receptor for fibronectin and fibrinogen. It recognizes the sequence R-G-D in its ligands. ITGA5:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGA5:ITGB1 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. ITGA5:ITGB1 is a receptor for IL1B and binding is essential for IL1B signaling. ITGA5:ITGB3 is a receptor for soluble CD40LG and is required for CD40/CD40LG signaling.; (Microbial infection) Integrin ITGA5:ITGB1 acts as a receptor for Human metapneumovirus.; (Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human parvovirus B19.; (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell junction, focal adhesion. Cell surface.
Target Protein Families
Integrin alpha chain family
Target Synonyms
CD49 antigen-like family member E; CD49e; Fibronectin receptor subunit alpha; Fibronectin receptor; alpha subunit; FNRA; Integrin alpha 5 (fibronectin receptor alpha); Integrin alpha-5; Integrin alpha-5 light chain; Integrin alpha-F; Integrin; alpha 5 (fibronectin receptor; alpha polypeptide); ITA5_HUMAN; Itga5; Very late activation protein 5; alpha subunit; VLA-5; VLA5; VLA5A
Target Background
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 5 subunit. This subunit associates with the beta 1 subunit to form a fibronectin receptor. This integrin may promote tumor invasion, and higher expression of this gene may be correlated with shorter survival time in lung cancer patients. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
Notification