-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IP3R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2200-2300 of human IP3R (Q14643) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IP3R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2200-2300 of human IP3R (Q14643) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16950A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IP3R |
| Target Synonyms | ACV; CLA4; IP3R; IP3R1; SCA15; SCA16; SCA29; INSP3R1; PPP1R94 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2200-2300 of human IP3R (Q14643). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVA | Uniprot ID | Q14643 |
Uniprot Id
Q14643
Target Species
Human
Target Name
ITPR1
Target Full Name
Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1
Target Function
Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
Target Involvement
Spinocerebellar ataxia 15 (SCA15); Spinocerebellar ataxia 29 (SCA29); Gillespie syndrome (GLSP)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Target Protein Families
InsP3 receptor family
Target Tissue Specificity
Widely expressed.
Target Synonyms
4; 5-trisphosphate receptor; 5-trisphosphate receptor type 1; DKFZp313E1334; DKFZp313N1434; inositol 1 4 5 triphosphate receptor type 1; Inositol 1 4 5 trisphosphate Receptor Type 1; Inositol 1; InsP3R1; IP3; IP3 receptor; IP3 receptor isoform 1; IP3R 1; IP3R; IP3R1; ITPR 1; Itpr1; ITPR1_HUMAN; SCA15; SCA16; SCA29; Type 1 inositol 1 4 5 trisphosphate receptor; Type 1 inositol 1; Type 1 InsP3 receptor
Target Background
This gene encodes an intracellular receptor for inositol 1, 4, 5-trisphosphate. Upon stimulation by inositol 1, 4, 5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene.
Notification