-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IPO13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 764-963 of human IPO13 (NP_055467.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IPO13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 764-963 of human IPO13 (NP_055467.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00260A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IPO13 |
| Target Synonyms | LGL2; IMP13; KAP13; RANBP13; IPO13 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 764-963 of human IPO13 (NP_055467.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IEALFLLVTSVTLTLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGFFTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY | Uniprot ID | O94829 |
Uniprot Id
O94829
Target Species
Human
Target Name
IPO13
Target Full Name
Importin-13
Target Function
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of UBC9, the RBM8A/MAGOH complex, PAX6 and probably other members of the paired homeobox family. Also mediates nuclear export of eIF-1A, and the cytoplasmic release of eIF-1A is triggered by the loading of import substrates onto IPO13.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Importin beta family
Target Tissue Specificity
Expressed in fetal brain, heart, intestine and kidney.
Target Synonyms
Imp 13; Imp13; Importin-13; Importin13; IPO 13; Ipo13; IPO13_HUMAN; Kap 13; Kap13; Karyopherin 13; Karyopherin-13; Karyopherin13; KIAA0274; Late gestation lung 2; Late gestation lung 2 protein; Lgl2; Ran binding protein 13; Ran-binding protein 13; RanBP 13; RanBP13
Target Background
This gene encodes a member of the importin-beta family of nuclear transport proteins. The encoded protein mediates the import of specific cargo proteins from the cytoplasm to the nucleus and is dependent on the Ras-related nuclear protein-GTPase system. The encoded protein is also involved in nuclear export of the eukaryotic translation initiation factor 1A.
Notification