-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IPO8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 878-1037 of human IPO8 (NP_006381.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IPO8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 878-1037 of human IPO8 (NP_006381.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10178A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IPO8 |
| Target Synonyms | VISS; RANBP8; IPO8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 878-1037 of human IPO8 (NP_006381.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRQLVNREDRSKAEKADMEENEEISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN | Uniprot ID | O15397 |
Uniprot Id
O15397
Target Species
Human
Target Name
IPO8
Target Full Name
Importin-8
Target Function
Seems to function in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro mediates the nuclear import of SRP19.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Importin beta family
Target Synonyms
FLJ26580; Imp 8; Imp8; Importin-8; Importin8; IPO 8; IPO8; IPO8_HUMAN; Ran binding protein 8; RAN BP8; Ran-binding protein 8; RANBP 8; RanBP8
Target Background
The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification