Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IQGAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1437-1631 of human IQGAP3 (NP_839943.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IQGAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1437-1631 of human IQGAP3 (NP_839943.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01418A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IQGAP3 |
| Target Synonyms | IQGAP3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1437-1631 of human IQGAP3 (NP_839943.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRRVLRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTFYEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLLIFLLNKKFLRK | Uniprot ID | Q86VI3 |
Uniprot Id
Q86VI3
Target Species
Human
Target Name
IQGAP3
Target Full Name
Ras GTPase-activating-like protein IQGAP3
Target Synonyms
IQ motif containing GTPase activating protein 3; IQGA3_HUMAN; IQGAP 3; IQGAP3; MGC10170; MGC10831; MGC1947; OTTHUMP00000031854; OTTHUMP00000031855; Ras GTPase activating like protein IQGAP3; Ras GTPase-activating-like protein IQGAP3
Target Background
Enables calmodulin binding activity and myosin VI light chain binding activity. Predicted to be involved in regulation of actin cytoskeleton organization. Predicted to act upstream of or within several processes, including intracellular signal transduction; positive regulation of macromolecule metabolic process; and positive regulation of mammary gland epithelial cell proliferation. Predicted to be located in cytosol. Predicted to be active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
