-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRAK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRAK4 (NP_057207.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRAK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRAK4 (NP_057207.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14492A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRAK4 |
| Target Synonyms | IPD1; IMD67; REN64; IRAK-4; NY-REN-64; [KD Validated] IRAK4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRAK4 (NP_057207.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV | Uniprot ID | Q9NWZ3 |
Uniprot Id
Q9NWZ3
Target Species
Human
Target Name
IRAK4
Target Full Name
Interleukin-1 receptor-associated kinase 4
Target Function
Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections.
Target Involvement
Recurrent isolated invasive pneumococcal disease 1 (IPD1); IRAK4 deficiency (IRAK4D)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, Pelle subfamily
Target Synonyms
IL-1 receptor-associated kinase 4; Interleukin 1 receptor associated kinase 4 mutant form 1; Interleukin-1 receptor-associated kinase 4; Interleukin1 receptor associated kinase 4; IPD1; IRAK 4; IRAK-4; IRAK4; IRAK4 mutated form 1; IRAK4_HUMAN; LOC 51135; NY REN 64; NY REN 64 antigen; NY-REN-64; REN64; Renal carcinoma antigen NY-REN-64
Target Background
This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification